DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CPK2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001326044.1 Gene:CPK2 / 820235 AraportID:AT3G10660 Length:646 Species:Arabidopsis thaliana


Alignment Length:148 Identity:57/148 - (38%)
Similarity:90/148 - (60%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            :|:.|:||:||..|:.|.:.|.|..|.||.:||...::.:|.|..|:|:.|::...|.|.:||||
plant   480 IAESLSEEEIAGLKQMFKMIDADNSGQITFEELKAGLKRVGANLKESEILDLMQAADVDNSGTID 544

  Fly    66 FPEFL--TMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 128
            :.||:  |:...|:   :.|:.:..||..||||.:|||:..||:......|  :.|..::||:|:
plant   545 YKEFIAATLHLNKI---EREDHLFAAFSYFDKDESGFITPDELQQACEEFG--VEDARIEEMMRD 604

  Fly   129 ADIDGDGQVNYEEFVTMM 146
            .|.|.||:::|.|||.||
plant   605 VDQDKDGRIDYNEFVAMM 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 57/148 (39%)
CPK2NP_001326044.1 PspC_subgroup_2 <45..>159 CDD:411408
STKc_CAMK 185..443 CDD:270687
PTZ00184 480..622 CDD:185504 55/146 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.