DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AT3G01830

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_566152.1 Gene:AT3G01830 / 820033 AraportID:AT3G01830 Length:146 Species:Arabidopsis thaliana


Alignment Length:158 Identity:38/158 - (24%)
Similarity:75/158 - (47%) Gaps:46/158 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFKEAFSLFDKDGDGTITTKELGTVMR-----------------SLGQNPTEA------ELQDMI 53
            |::..||.|||...|.::   :.|:.|                 :...||.|:      ||:|.:
plant    11 EYQRVFSCFDKSHQGKVS---VSTIERCVDAIKSGKRAVVDQEDTTNPNPEESTDDKSLELEDFV 72

  Fly    54 NEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLT 118
            ..|: :|                 ::.|.|::::|||:::::...  |:...|:.:::.|||..:
plant    73 KLVE-EG-----------------EEADKEKDLKEAFKLYEESEG--ITPKSLKRMLSLLGESKS 117

  Fly   119 DEEVDEMIREADIDGDGQVNYEEFVTMM 146
            .::.:.||.:.||:.||.:|::||..||
plant   118 LKDCEVMISQFDINRDGIINFDEFRAMM 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 38/158 (24%)
AT3G01830NP_566152.1 PTZ00184 11..145 CDD:185504 36/156 (23%)
EFh 86..146 CDD:238008 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.