DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AGD11

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_187405.1 Gene:AGD11 / 819937 AraportID:AT3G07490 Length:153 Species:Arabidopsis thaliana


Alignment Length:138 Identity:59/138 - (42%)
Similarity:88/138 - (63%) Gaps:2/138 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAR 75
            ||....|.:||::|||.||.:||...:.:||....:.:|..||.::|.:|:|.:|..||..:...
plant     4 AELARIFQMFDRNGDGKITKQELNDSLENLGIYIPDKDLVQMIEKIDLNGDGYVDIEEFGGLYQT 68

  Fly    76 KMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEK--LTDEEVDEMIREADIDGDGQVN 138
            .|::.|.||::||||.|||::.:|||:..|||.|:.:||.|  .|.|:...||.:.|:||||.||
plant    69 IMEERDEEEDMREAFNVFDQNRDGFITVEELRSVLASLGLKQGRTLEDCKRMISKVDVDGDGMVN 133

  Fly   139 YEEFVTMM 146
            ::||..||
plant   134 FKEFKQMM 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 59/138 (43%)
AGD11NP_187405.1 PTZ00184 4..141 CDD:185504 57/136 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.