DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AT2G41410

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_181672.1 Gene:AT2G41410 / 818739 AraportID:AT2G41410 Length:216 Species:Arabidopsis thaliana


Alignment Length:142 Identity:52/142 - (36%)
Similarity:76/142 - (53%) Gaps:11/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDADGNGTIDFPEFLTMMAR 75
            |..:||.|.|:|.||.::..:|..::..|. :.|::.|:..|:.|||....|.|...:    :|.
plant    70 ELVQAFKLIDRDDDGVVSRGDLAALISRLSHEPPSQEEVSLMLREVDGGDGGCISLED----LAS 130

  Fly    76 KMKDTDSE-----EEIREAFRVFDKDGNGFISAAELRHVMTNLG-EKLTDEEVDEMIREADIDGD 134
            ::..|..|     ||:||.|.:||.|.||.|||.||..|...:| |:.|.||...||...|.:||
plant   131 RVAGTSGEGSVETEELREVFEIFDVDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGNGD 195

  Fly   135 GQVNYEEFVTMM 146
            |.|.:::|..||
plant   196 GFVCFDDFCRMM 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 52/142 (37%)
AT2G41410NP_181672.1 PTZ00184 70..208 CDD:185504 52/142 (37%)
EFh 70..133 CDD:238008 19/66 (29%)
EFh 145..207 CDD:238008 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.