DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CAM2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001189724.1 Gene:CAM2 / 818710 AraportID:AT2G41110 Length:161 Species:Arabidopsis thaliana


Alignment Length:161 Identity:133/161 - (82%)
Similarity:144/161 - (89%) Gaps:12/161 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGD------------GTITTKELGTVMRSLGQNPTEAELQDMI 53
            ||||||::||:||||||||||||||            |.||||||||||||||||||||||||||
plant     1 MADQLTDDQISEFKEAFSLFDKDGDGMLHPPFPSIIVGCITTKELGTVMRSLGQNPTEAELQDMI 65

  Fly    54 NEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLT 118
            |||||||||||||||||.:|||||||||||||::|||||||||.|||||||||||||||||||||
plant    66 NEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLT 130

  Fly   119 DEEVDEMIREADIDGDGQVNYEEFVTMMTSK 149
            ||||||||:|||:|||||:||||||.:|.:|
plant   131 DEEVDEMIKEADVDGDGQINYEEFVKVMMAK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 132/159 (83%)
CAM2NP_001189724.1 PTZ00184 1..161 CDD:185504 132/159 (83%)
EFh 12..86 CDD:238008 58/73 (79%)
EFh 97..159 CDD:238008 53/61 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1856
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H116117
Inparanoid 1 1.050 275 1.000 Inparanoid score I893
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 1 1.000 - - otm3085
orthoMCL 1 0.900 - - OOG6_100851
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.