DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CPK20

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_181425.1 Gene:CPK20 / 818476 AraportID:AT2G38910 Length:583 Species:Arabidopsis thaliana


Alignment Length:146 Identity:54/146 - (36%)
Similarity:87/146 - (59%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            :|:.|:||:||..||.|.:.|.|..|.||.:||...:..:|.:..::|:..::...|.|.:||||
plant   428 IAESLSEEEIAGLKEMFKMIDTDNSGHITLEELKKGLDRVGADLKDSEILGLMQAADIDNSGTID 492

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            :.||:..|.. :...:.|:.:..||..||:||:|:|:..||:......|  |.|..:|:::||.|
plant   493 YGEFIAAMVH-LNKIEKEDHLFTAFSYFDQDGSGYITRDELQQACKQFG--LADVHLDDILREVD 554

  Fly   131 IDGDGQVNYEEFVTMM 146
            .|.||:::|.|||.||
plant   555 KDNDGRIDYSEFVDMM 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 54/146 (37%)
CPK20NP_181425.1 STKc_CAMK 134..391 CDD:270687
FRQ1 432..572 CDD:227455 53/142 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.