DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CML30

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_179170.1 Gene:CML30 / 816061 AraportID:AT2G15680 Length:187 Species:Arabidopsis thaliana


Alignment Length:143 Identity:58/143 - (40%)
Similarity:83/143 - (58%) Gaps:2/143 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70
            ::..:.|.:..||.||.|.||.|:..|...|:|:|||.....::..:...||.||:|.|||.||:
plant    44 SQPSVNEMRRVFSRFDLDKDGKISQTEYKVVLRALGQERAIEDVPKIFKAVDLDGDGFIDFREFI 108

  Fly    71 TMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDG 135
            .  |.|........:||.:|..||.:|:|.|||.|:..|:..|||:.:.|:.:.|:|..|.||||
plant   109 D--AYKRSGGIRSSDIRNSFWTFDLNGDGKISAEEVMSVLWKLGERCSLEDCNRMVRAVDADGDG 171

  Fly   136 QVNYEEFVTMMTS 148
            .||.|||:.||:|
plant   172 LVNMEEFIKMMSS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 58/143 (41%)
CML30NP_179170.1 PTZ00184 44..185 CDD:185504 58/143 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.