DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and EFHD2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_077305.2 Gene:EFHD2 / 79180 HGNCID:28670 Length:240 Species:Homo sapiens


Alignment Length:137 Identity:36/137 - (26%)
Similarity:62/137 - (45%) Gaps:11/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
            :.:.:||.:.::.|..:|...||.|...||..:|..||...|...|::||.|||.|.:..:.|.|
Human    88 EFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFRE 152

  Fly    69 FLTMMARKMKDTDSEEE----IREAFRVFDKDGNGFISAA---ELRHVMTNLGEKLTDE---EVD 123
            || ::.||....:.:|:    :.......|....|...|.   |.:....|:..:..:|   |.:
Human   153 FL-LIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQE 216

  Fly   124 EMIREAD 130
            |..::|:
Human   217 ERKKQAE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 36/137 (26%)
EFHD2NP_077305.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..38
EFh 96..154 CDD:238008 20/57 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.