DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Capsl

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_083617.2 Gene:Capsl / 75568 MGIID:1922818 Length:208 Species:Mus musculus


Alignment Length:139 Identity:44/139 - (31%)
Similarity:65/139 - (46%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTD 81
            |.:.|.:.:.|:..||....:........:.|.:::....|.||:|||||.|||..:...|... 
Mouse    48 FRIMDDNNNRTLDFKEFLKGLNDYAVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLRPPMSRA- 111

  Fly    82 SEEEIREAFRVFDKDGNGFISAAELR-------HVMTNLGEKLTDEEV-----DEMIREADIDGD 134
            .:|.|.:|||..||.|:|.|:..:||       |.....|| .|:|:|     |..  ::..|.|
Mouse   112 RKEVIMKAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGE-WTEEQVFRKFLDNF--DSPYDKD 173

  Fly   135 GQVNYEEFV 143
            |.|..|||:
Mouse   174 GLVTPEEFM 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 44/139 (32%)
CapslNP_083617.2 EF-hand_7 44..101 CDD:290234 15/52 (29%)
EFh 46..101 CDD:238008 15/52 (29%)
EFh 79..138 CDD:238008 24/59 (41%)
EF-hand_7 80..140 CDD:290234 24/60 (40%)
EF-hand_7 116..185 CDD:290234 25/70 (36%)
EFh 116..182 CDD:298682 24/68 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.