DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Ncs1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_077342.1 Gene:Ncs1 / 65153 RGDID:68417 Length:190 Species:Rattus norvegicus


Alignment Length:144 Identity:34/144 - (23%)
Similarity:67/144 - (46%) Gaps:32/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAR 75
            |.|::.:..|...||.|    :..|.               :.|..|.:.:|.|:|.||:..::.
  Rat    46 AGFQKIYKQFFPFGDPT----KFATF---------------VFNVFDENKDGRIEFSEFIQALSV 91

  Fly    76 KMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE------KLTDEE------VDEMIRE 128
            ..:.| .:|::|.||:::|.|.:|:|:..|:..::..:.:      :|.:||      ||.:...
  Rat    92 TSRGT-LDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAM 155

  Fly   129 ADIDGDGQVNYEEF 142
            .|.:.||::..:||
  Rat   156 MDKNADGKLTLQEF 169

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 34/144 (24%)
Ncs1NP_077342.1 FRQ1 20..179 CDD:227455 34/144 (24%)