DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and RCN2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001258766.1 Gene:RCN2 / 5955 HGNCID:9935 Length:335 Species:Homo sapiens


Alignment Length:176 Identity:40/176 - (22%)
Similarity:67/176 - (38%) Gaps:44/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLT 71
            |||....:......|.|.||.:|..||.:.::...::....|.:....|.|.:.:.|:.:.|:..
Human    60 EEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDEYNI 124

  Fly    72 MMARKMKDTD--------SEEEIREAFRV----------------------FDK----DGNG--- 99
            .|..::.|.|        .||..|:.|.:                      |:|    .|.|   
Human   125 QMYDRVIDFDENTALDDAEEESFRKEFAICKKQSFCFWLLRFNLHLKDKKRFEKANQDSGPGLSL 189

  Fly   100 --FISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFV 143
              ||:......|     :.:|:..:.|.:.|.|.:|||.|:.|||:
Human   190 EEFIAFEHPEEV-----DYMTEFVIQEALEEHDKNGDGFVSLEEFL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 40/176 (23%)
RCN2NP_001258766.1 EFh_CREC_RCN2 29..314 CDD:320022 40/176 (23%)
EF-hand motif 29..59 CDD:320022
EF-hand motif 65..94 CDD:320022 7/28 (25%)
EF-hand motif 101..130 CDD:320022 6/28 (21%)
EF-hand motif 171..200 CDD:320022 6/28 (21%)
EF-hand motif 208..237 CDD:320022 10/23 (43%)
EF-hand motif 249..278 CDD:320022
EF-hand motif 285..314 CDD:320022
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.