DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Nox

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001097336.1 Gene:Nox / 5740310 FlyBaseID:FBgn0085428 Length:1340 Species:Drosophila melanogaster


Alignment Length:123 Identity:34/123 - (27%)
Similarity:62/123 - (50%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ITTKELGTVMRSLGQNP--TEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAF 90
            |..:|...::.|  :||  ||...|..    |.|.:|:|...||:..: .:.....::::||..|
  Fly   347 IRREEFQKIVTS--KNPFFTERVFQIF----DKDNSGSISLQEFIDAI-HQFSGQSADDKIRFLF 404

  Fly    91 RVFDKDGNGFISAAEL----RHVMTNLGEKLTDEEVDE----MIREADIDGDGQVNYE 140
            :|:|.||:|.|...||    ||.:...|.:.:::::::    |..:||....|::.||
  Fly   405 KVYDIDGDGLIQHKELHDVIRHCIKENGMEFSEDQIEDLTSAMFEDADPHNSGEITYE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 34/123 (28%)
NoxNP_001097336.1 FRQ1 314..466 CDD:227455 34/123 (28%)
EFh 365..425 CDD:238008 19/64 (30%)
EFh 399..462 CDD:238008 18/62 (29%)
Ferric_reduct 560..700 CDD:280043
NOX_Duox_like_FAD_NADP 744..>819 CDD:99783
FNR_like <1136..>1178 CDD:297884
NAD_binding_6 1158..1325 CDD:285298
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.