DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and myl4

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001020354.1 Gene:myl4 / 574004 ZFINID:ZDB-GENE-050626-112 Length:187 Species:Danio rerio


Alignment Length:144 Identity:65/144 - (45%)
Similarity:89/144 - (61%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TEEQIAEFKEAFSLFDKD--GDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT--IDF 66
            |.:||.||||.|.|||:.  .:..||..:.|.|||:||.|||.||:..::.:...:...|  |||
Zfish    39 TADQIEEFKETFMLFDRTPASEMKITYAQCGDVMRALGLNPTNAEVLKVLGKPRPEEMNTKMIDF 103

  Fly    67 PEFLTMM--ARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREA 129
            ..||.|.  ..:.||..:.|:..|..|||||:|||.:..||||||:..||||:|:.||::::...
Zfish   104 ETFLPMFQHVSRSKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTESEVEQLMAGQ 168

  Fly   130 DIDGDGQVNYEEFV 143
            : ||:|.||||.||
Zfish   169 E-DGNGCVNYEAFV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 65/144 (45%)
myl4NP_001020354.1 PTZ00184 39..186 CDD:185504 65/144 (45%)
EFh 124..185 CDD:238008 31/59 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.