DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and scgn

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001005776.1 Gene:scgn / 573010 ZFINID:ZDB-GENE-041010-82 Length:272 Species:Danio rerio


Alignment Length:154 Identity:37/154 - (24%)
Similarity:73/154 - (47%) Gaps:37/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DQLTEEQIAEFKEAF-SLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF 66
            |::|:|::.:.|::| |.:|...||.:..:||..::....:|                       
Zfish    48 DKITDERVQQIKKSFMSAYDATFDGRLQIEELANMILPQEEN----------------------- 89

  Fly    67 PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNL---------GEKLTDEEV 122
              || ::.|:....|:..|..:.:|.:|.|.:|:||||||::.:.:|         ..|| ||..
Zfish    90 --FL-LIFRREAPLDNSVEFMKIWRKYDADSSGYISAAELKNFLKDLFLQHKKKIPPNKL-DEYT 150

  Fly   123 DEMIREADIDGDGQVNYEEFVTMM 146
            |.|::..|.:.||:::..:...::
Zfish   151 DAMMKIFDKNKDGRLDLNDLARIL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 37/154 (24%)
scgnNP_001005776.1 EFh 13..83 CDD:298682 11/34 (32%)
EF-hand_7 15..83 CDD:290234 11/34 (32%)
EFh 105..175 CDD:238008 21/71 (30%)
EF-hand_7 107..174 CDD:290234 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.