DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and efhd2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001313422.1 Gene:efhd2 / 571114 ZFINID:ZDB-GENE-060531-152 Length:233 Species:Danio rerio


Alignment Length:112 Identity:31/112 - (27%)
Similarity:48/112 - (42%) Gaps:20/112 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
            :.:.:||.:.::.|..:|.:.|..|...||..:|..||...|...|::||.|||.|.:|.:.|.|
Zfish    81 EFSRKQIKDMEKMFKQYDSEKDNYIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDLDGKLSFRE 145

  Fly    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE 115
            ||.                    :|.|...|.::.....||:..|.|
Zfish   146 FLL--------------------IFRKAAAGELAEDSGLHVLARLSE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 31/112 (28%)
efhd2NP_001313422.1 EFh 89..147 CDD:238008 20/57 (35%)
EF-hand_7 90..147 CDD:290234 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.