DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Chp1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_062743.1 Gene:Chp1 / 56398 MGIID:1927185 Length:195 Species:Mus musculus


Alignment Length:162 Identity:46/162 - (28%)
Similarity:78/162 - (48%) Gaps:26/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQD-MINEVDADGNGTIDFPEF 69
            :..||......|:..||..:||::.::...: ..|..||    |.| :||...::|...::|..|
Mouse    24 SHSQITRLYSRFTSLDKGENGTLSREDFQRI-PELAINP----LGDRIINAFFSEGEDQVNFRGF 83

  Fly    70 LTMMA--------RKMKDTDSEEEIRE-------AFRVFDKDGNGFISAAELRHVMTNL-GEKLT 118
            :..:|        .|.||.:..|.:..       |||::|.|.:..||..||..|:..: |..::
Mouse    84 MRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNIS 148

  Fly   119 DEEV----DEMIREADIDGDGQVNYEEFVTMM 146
            ||::    |..|:|||.|||..:::.|||.::
Mouse   149 DEQLGSIADRTIQEADQDGDSAISFTEFVKVL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 46/162 (28%)
Chp1NP_062743.1 Nuclear export signal 2. /evidence=ECO:0000250 176..185 2/5 (40%)
FRQ1 1..182 CDD:227455 46/162 (28%)
Necessary for association with microtubule and interaction with GAPDH. /evidence=ECO:0000250 2..6
Nuclear export signal 1. /evidence=ECO:0000250 138..147 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.