DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and ncalda

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001107882.1 Gene:ncalda / 556178 ZFINID:ZDB-GENE-080220-28 Length:193 Species:Danio rerio


Alignment Length:144 Identity:38/144 - (26%)
Similarity:71/144 - (49%) Gaps:32/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76
            |||:.:..|...||   .:|....|.|:.                ||:|:|||||.||:..::..
Zfish    47 EFKKIYGNFFPYGD---ASKFAEHVFRTF----------------DANGDGTIDFREFIIALSVT 92

  Fly    77 MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNL------------GEKLTDEEVDEMIREA 129
            .:. ..|::::.||.::|.||||:||.:|:..::..:            .|...::..:::.|:.
Zfish    93 SRG-KLEQKLKWAFSMYDLDGNGYISKSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQM 156

  Fly   130 DIDGDGQVNYEEFV 143
            |.:.||:::.|||:
Zfish   157 DTNRDGKLSLEEFI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 38/144 (26%)
ncaldaNP_001107882.1 FRQ1 14..179 CDD:227455 38/144 (26%)
EFh <36..89 CDD:298682 19/60 (32%)
EFh 65..126 CDD:238008 23/77 (30%)
EFh 100..174 CDD:238008 18/71 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.