DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and cabp5b

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001018568.1 Gene:cabp5b / 553766 ZFINID:ZDB-GENE-050522-146 Length:169 Species:Danio rerio


Alignment Length:148 Identity:63/148 - (42%)
Similarity:98/148 - (66%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69
            |.:|:|.|.:|||:.||||.||.|:.|:||.:||::|..|||.||.::...::.:..|::||.:|
Zfish    20 LADEEIDELREAFTEFDKDKDGLISCKDLGNLMRTMGYMPTEMELIELSQNINMNLGGSVDFQDF 84

  Fly    70 LTMMARKMKDTDSE----EEIREAFRVFDKDGNGFISAAELRHVMTN-LGEKLTDEEVDEMIREA 129
            :.:||.|:....:.    :|:::||:.||.||:|.|:..|||..|.. |||.....||:.::||.
Zfish    85 VDLMAPKLLAETAGMIGIKELKDAFKEFDMDGDGSITTEELRLAMLKLLGENTNRREVEAVVREV 149

  Fly   130 DIDGDGQVNYEEFVTMMT 147
            |.:|||.|::||||.||:
Zfish   150 DNNGDGTVDFEEFVKMMS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 63/148 (43%)
cabp5bNP_001018568.1 PTZ00184 20..166 CDD:185504 61/145 (42%)
EFh 27..89 CDD:238008 26/61 (43%)
EFh 104..167 CDD:238008 30/62 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.