DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and si:ch211-197n1.2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_697171.3 Gene:si:ch211-197n1.2 / 553519 ZFINID:ZDB-GENE-080225-6 Length:890 Species:Danio rerio


Alignment Length:191 Identity:40/191 - (20%)
Similarity:74/191 - (38%) Gaps:42/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSL--GQNPTEAELQDMINEVDADGNGT 63
            :...|...:..:..:.|...|:.....:|.:::..:::.|  .|..|..|::.:.:.:....:||
Zfish   579 LVKSLVANRYKDVLQVFEELDEKNTRRLTQEDMYQLLKRLVPHQEVTRGEVRRLWSSLFTQQDGT 643

  Fly    64 IDFPEFLTMMA---------------RKMKDTD-------------------------SEEEIRE 88
            :||.:||....               .|..|.|                         |..|:..
Zfish   644 VDFQQFLRHFGPSPRSCCFPNAKRNPPKRGDNDFMRLSNRLSYVSDILVDALRAKVEMSVSELWT 708

  Fly    89 AFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK 149
            .|...|..|.||:|:.|.:.::.:|...|:..|.|.:.|:.||:.||.|:|.||:....|:
Zfish   709 EFSEMDFSGTGFVSSDEFKEILMSLCVHLSQYECDVLARKFDINHDGCVSYLEFLRPFLSQ 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 39/189 (21%)
si:ch211-197n1.2XP_697171.3 EFh 478..539 CDD:298682
EF-hand_7 593..653 CDD:290234 13/59 (22%)
EF-hand_7 710..764 CDD:290234 20/53 (38%)
EFh 710..764 CDD:238008 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.