DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and PPP3R2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_671709.2 Gene:PPP3R2 / 5535 HGNCID:9318 Length:170 Species:Homo sapiens


Alignment Length:147 Identity:47/147 - (31%)
Similarity:79/147 - (53%) Gaps:9/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            |......::|......|...|.|..|:::.:|..: :..|..||.   ::.:|:..|.||:|.:|
Human    11 MCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMS-LPELRHNPL---VRRVIDVFDTDGDGEVD 71

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNL-GEKLTD----EEVDEM 125
            |.||:...::.....|.|:::|.||.::|.|.:|:||..||..|:..: |..|||    :.||:.
Human    72 FKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKT 136

  Fly   126 IREADIDGDGQVNYEEF 142
            |...|.||||::::|||
Human   137 IIILDKDGDGKISFEEF 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 47/147 (32%)
PPP3R2NP_671709.2 FRQ1 13..159 CDD:227455 46/145 (32%)
Calcineurin A binding. /evidence=ECO:0000250|UniProtKB:P63098 131..136 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.