DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and cetn3

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001018335.1 Gene:cetn3 / 552931 ZFINID:ZDB-GENE-050522-152 Length:167 Species:Danio rerio


Alignment Length:144 Identity:59/144 - (40%)
Similarity:88/144 - (61%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
            :||:||..|.||||.||..|.|..|...||...||:||....:.::..::.:.|.:|.|.|.|.:
Zfish    21 ELTDEQKDEIKEAFELFGTDKDKEIDYHELKVAMRALGFEVKKVDVLKILKDYDREGTGKISFED 85

  Fly    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDG 133
            |..::...:.:.|.:|||.:||::||.|..|.||...||.|...|||.::||::..||.|.|.||
Zfish    86 FREVVTDMILERDPKEEILKAFKLFDDDETGKISLRNLRRVARELGEDMSDEDLRAMIDEFDTDG 150

  Fly   134 DGQVNYEEFVTMMT 147
            ||::|.:||:::||
Zfish   151 DGEINQDEFISIMT 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 59/144 (41%)
cetn3NP_001018335.1 PTZ00183 13..167 CDD:185503 59/144 (41%)
EFh 29..91 CDD:238008 22/61 (36%)
EFh 102..164 CDD:238008 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.