DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and capsla

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001017676.1 Gene:capsla / 550371 ZFINID:ZDB-GENE-030131-7291 Length:188 Species:Danio rerio


Alignment Length:136 Identity:39/136 - (28%)
Similarity:62/136 - (45%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTD 81
            |...|.||..::..:|....::..|.:....:.|.:...:|.||:|:|:|.|||..:...|... 
Zfish    28 FRSMDDDGSKSLDFQEFVRGLQDYGVSVGRDQAQQIFAMMDKDGSGSINFDEFLEKLRPPMSSA- 91

  Fly    82 SEEEIREAFRVFDKDGNGFISAAELR-------HVMTNLGEKLTDEEVDEMIREADI--DGDGQV 137
            ..:.||:||:.|||.|:|..:..:|:       |.....||....:.....:...|.  |.||:|
Zfish    92 RMQVIRQAFQKFDKSGDGVETVEDLQGVYNSKHHPKYKSGEWTETQVFHSFLDSFDSPHDKDGKV 156

  Fly   138 NYEEFV 143
            ..||||
Zfish   157 TLEEFV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 39/136 (29%)
capslaNP_001017676.1 EF-hand_7 24..82 CDD:290234 15/53 (28%)
EFh 26..82 CDD:238008 15/53 (28%)
EFh 59..>109 CDD:238008 19/50 (38%)
EF-hand_7 60..120 CDD:290234 21/60 (35%)
EF-hand_7 96..165 CDD:290234 22/67 (33%)
EFh 96..162 CDD:298682 20/65 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.