DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CALML5

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_059118.2 Gene:CALML5 / 51806 HGNCID:18180 Length:146 Species:Homo sapiens


Alignment Length:149 Identity:75/149 - (50%)
Similarity:107/149 - (71%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            ||.:||.|:.|::|:|||..|.||:|||..:|||..:::.|:|.:||:|:.:|:|||:||:|.|.
Human     1 MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEIS 65

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            |.|||| .|:|.:  ...|:::.|||.||:||:|.|:..|||..|..||:.|..||:|.||||||
Human    66 FQEFLT-AAKKAR--AGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREAD 127

  Fly   131 IDGDGQVNYEEFVTMMTSK 149
            :|.||:||||||..|:..:
Human   128 VDQDGRVNYEEFARMLAQE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 75/147 (51%)
CALML5NP_059118.2 PTZ00184 1..143 CDD:185504 74/144 (51%)
EFh 12..74 CDD:238008 31/62 (50%)
EFh 82..144 CDD:238008 35/61 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.