DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and SDF4

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_024303241.1 Gene:SDF4 / 51150 HGNCID:24188 Length:407 Species:Homo sapiens


Alignment Length:210 Identity:44/210 - (20%)
Similarity:76/210 - (36%) Gaps:91/210 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FSLFDKDGDGTITTKELGT-VMRSLGQNPTEA--ELQDMINEVDADGNGTIDFPEF-LTMMARKM 77
            ||..|.:.|..|:.||:.. :|....::..||  |.:.....||.||:|.:.:.|: :..:|.| 
Human   107 FSKVDVNTDRKISAKEMQRWIMEKTAEHFQEAMEESKTHFRAVDPDGDGHVSWDEYKVKFLASK- 170

  Fly    78 KDTDSEEEIREAFRVFDK---DGNGFISAAELRHVMTNLGEK------------LTDEE------ 121
              ..||:|:.:|.|:.::   |       .|.:.|:.||.::            ||:||      
Human   171 --GHSEKEVADAIRLNEELKVD-------EETQEVLENLKDRWYQADSPPADLLLTEEEFLSFLH 226

  Fly   122 -----------VDEMIRE---------------------------------------------AD 130
                       |.|::|:                                             ||
Human   227 PEHSRGMLRFMVKEIVRDLGEAGSSLAGTPGPRTDWQGPGIVGRSGQVLREPQPGCGLTHSRLAD 291

  Fly   131 IDGDGQVNYEEFVTM 145
            .|||.|::..||:::
Human   292 QDGDKQLSVPEFISL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 44/210 (21%)
SDF4XP_024303241.1 EFh_CREC_cab45 67..392 CDD:320023 44/210 (21%)
EF-hand motif 67..95 CDD:320023
EF-hand motif 102..131 CDD:320023 8/23 (35%)
EF-hand motif 141..170 CDD:320023 8/28 (29%)
EF-hand motif 199..229 CDD:320023 6/29 (21%)
EF-hand motif 237..311 CDD:320023 11/70 (16%)
EF-hand motif 327..356 CDD:320023
EF-hand motif 363..392 CDD:320023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.