DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Hpcal4

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_059053.1 Gene:Hpcal4 / 50872 RGDID:708491 Length:191 Species:Rattus norvegicus


Alignment Length:155 Identity:40/155 - (25%)
Similarity:73/155 - (47%) Gaps:17/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKD-GDGTITTKELGTV-MRSLGQNPTEAELQDMINEVDADGNGTIDF 66
            |.||....|.|:.:..|.|| ..|.:..:|...: ::...........|......|.:|:|||||
  Rat    18 QNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDF 82

  Fly    67 PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNL-------------GEKLT 118
            .||:..::...:.: .|:::..||.::|.||:|.|:..|:..::..:             .:.||
  Rat    83 REFICALSVTSRGS-FEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLT 146

  Fly   119 DEE-VDEMIREADIDGDGQVNYEEF 142
            .:: ||::.::.|.|.|.|:..|||
  Rat   147 PQQRVDKIFKKMDQDKDDQITLEEF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 40/155 (26%)
Hpcal4NP_059053.1 FRQ1 13..181 CDD:227455 40/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.