DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Calm5

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001008706.1 Gene:Calm5 / 494124 MGIID:3511177 Length:140 Species:Mus musculus


Alignment Length:124 Identity:48/124 - (38%)
Similarity:82/124 - (66%) Gaps:4/124 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEE 85
            :::.||.|..:|||.||:.||:|.:..||:.:|:::|.||:|.|.|.||.    :.:|....|:|
Mouse     8 EENKDGHINVQELGDVMKQLGKNLSHEELKALISKLDTDGDGKISFEEFF----KSIKKYTKEQE 68

  Fly    86 IREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVT 144
            ::..|.|.|::|:|:|:..||:..::.:||.|:.||::.||.....|.||:||||:|::
Mouse    69 LQAMFSVLDQNGDGYITVDELKEGLSKMGEPLSQEELEGMIHVFGADQDGKVNYEQFLS 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 48/124 (39%)
Calm5NP_001008706.1 EFh 10..56 CDD:238008 20/45 (44%)
EFh 35..94 CDD:238008 22/62 (35%)
EF-hand_7 36..91 CDD:290234 21/58 (36%)
EFh 68..128 CDD:238008 24/60 (40%)
EF-hand_7 69..129 CDD:290234 23/59 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.