DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and rcvrn.2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001008164.1 Gene:rcvrn.2 / 493526 XenbaseID:XB-GENE-5807318 Length:193 Species:Xenopus tropicalis


Alignment Length:117 Identity:27/117 - (23%)
Similarity:59/117 - (50%) Gaps:4/117 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQN-PTEAELQDMINEVDADGNGTIDFPEF 69
            :::::.::.|:||  .:..:|.||..|...:..:...| ..::..:.:....|.:.:||:||.|:
 Frog    24 SDDELCKWYESFS--KQSPNGKITRTEFEKIYANFFPNSDPKSYARHVFRSFDTNEDGTLDFREY 86

  Fly    70 LTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEE 121
            :..: .......:..::..||.:||.|.||.||..|:..::|.:.:.:..||
 Frog    87 IIAL-HLTSSGKTSLKLEWAFSLFDVDKNGEISKVEVLEIITAIFKMIPPEE 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 27/117 (23%)
rcvrn.2NP_001008164.1 FRQ1 14..177 CDD:227455 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.