DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cam and pdcd6

DIOPT Version :9

Sequence 1:	NP_001246276.1	Gene:	Cam / 36329	FlyBaseID:	FBgn0000253	Length:	149	Species:	Drosophila melanogaster
Sequence 2:	NP_001008004.1	Gene:	pdcd6 / 493366	XenbaseID:	XB-GENE-960916	Length:	184	Species:	Xenopus tropicalis

Alignment Length:	134	Identity:	36/134 - (26%)
Similarity:	63/134 - (47%)	Gaps:	20/134 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 FSLFDKDGDGTITTKELGTVMRSLGQNP-TEAELQDMINEVDADGNGTIDFPEF------LTMMA 74
            |...|:|..|.|:..||...:.:....| ..|.:..:|:..|.|..|.::|.||      :|
Frog    25 FQRVDRDRSGVISDTELQQALSNGTWTPFNPATVNSIISMFDRDHKGGVNFNEFSGVWKYIT--- 86

  Fly    75 RKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNY 139
                      :.:..||.:|:|.:|.|...||:..::..|.:|:|:..|.:||:.|....|||.:
Frog    87 ----------DWQNIFRTYDRDNSGLIDKNELKQALSGFGYRLSDQFYDVLIRKFDRQRRGQVAF 141

  Fly   140 EEFV 143
            ::|:
Frog   142 DDFI 145

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cam	NP_001246276.1	PTZ00184	1..149	CDD:185504	36/134 (27%)
pdcd6	NP_001008004.1	EFh_PEF_ALG-2	20..184	CDD:320058	36/134 (27%)
		EF-hand motif	20..49	CDD:320058	7/23 (30%)
		EF-hand motif	57..86	CDD:320058	7/28 (25%)
		EF-hand motif	87..117	CDD:320058	8/29 (28%)
		EF-hand motif	123..152	CDD:320058	8/23 (35%)
		EF-hand motif	153..184	CDD:320058
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910