DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and MYL4

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_011523141.2 Gene:MYL4 / 4635 HGNCID:7585 Length:228 Species:Homo sapiens


Alignment Length:143 Identity:59/143 - (41%)
Similarity:89/143 - (62%) Gaps:7/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFKEAFSLFDK--DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGT--IDFPEFLTM 72
            ||||||||||:  .|:..||..:.|.|:|:||||||.||:..::.:...:....  :||..||.:
Human    86 EFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPI 150

  Fly    73 MAR--KMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDG 135
            :..  :.|:..:.|:..|..|||||:.||.:..||||||:..||||:|:.||::::...: |.:|
Human   151 LQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQE-DANG 214

  Fly   136 QVNYEEFVTMMTS 148
            .:|||.||..:.|
Human   215 CINYEAFVKHIMS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 59/143 (41%)
MYL4XP_011523141.2 EFh_PEF 86..227 CDD:330173 58/141 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.