DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and MYL1

DIOPT Version :10

Sequence 1:NP_523710.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_524144.1 Gene:MYL1 / 4632 HGNCID:7582 Length:194 Species:Homo sapiens


Alignment Length:149 Identity:66/149 - (44%)
Similarity:96/149 - (64%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI-NEVDADGNG-TIDF 66
            :.::||..||||||.|||:.||..||..::|.|:|:||.|||.||::.:: |..:.:.|. .|:|
Human    46 EFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEF 110

  Fly    67 PEFLTMM--ARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREA 129
            .:||.||  ....||..:.|:..|..|||||:|||.:..||||||:..||||:.:|||:.::...
Human   111 EQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQ 175

  Fly   130 DIDGDGQVNYEEFVTMMTS 148
            : |.:|.:|||.||..:.|
Human   176 E-DSNGCINYEAFVKHIMS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_523710.1 PTZ00184 1..149 CDD:185504 66/149 (44%)
MYL1NP_524144.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
PTZ00184 45..193 CDD:185504 65/147 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.