DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Acam

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster


Alignment Length:146 Identity:99/146 - (67%)
Similarity:126/146 - (86%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
            :||||||||||:||..|||:|.|.|.|:||||:||:||||||||||||:|.|.:.:.||.::|.|
  Fly     3 ELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTE 67

  Fly    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDG 133
            |..:||::|::||:|||:||||::||:||:||||.||||.||.|||||:||||:||||||||.||
  Fly    68 FCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDG 132

  Fly   134 DGQVNYEEFVTMMTSK 149
            ||.:||||||.|::.|
  Fly   133 DGMINYEEFVWMISQK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 98/144 (68%)
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 98/144 (68%)
EFh 11..73 CDD:238008 37/61 (61%)
EFh 84..146 CDD:238008 47/61 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467886
Domainoid 1 1.000 96 1.000 Domainoid score I1913
eggNOG 1 0.900 - - E33208_3BAEQ
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I904
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46902
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
87.890

Return to query results.
Submit another query.