DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and calb2b

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_957005.1 Gene:calb2b / 393684 ZFINID:ZDB-GENE-040426-1668 Length:269 Species:Danio rerio


Alignment Length:166 Identity:41/166 - (24%)
Similarity:79/166 - (47%) Gaps:24/166 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSL-----GQNPTEAELQDMINE----VDADG 60
            |.|...::|.:.::.||.||:|.|..|||...:|.|     ..:|:.|..:|.:.|    .|.:|
Zfish    13 LAELTASQFLDIWNKFDADGNGCIEGKELENFIRELEIARKTADPSNASFKDRMKEFMQKFDENG 77

  Fly    61 NGTIDFPEFLTMMARK-------MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNL----- 113
            :|.|:..|...::..:       .:...|..|...|:|.:|.|.:|:|.:.||:..:::|     
Zfish    78 DGKIEMSELAQILPTEENFLLCFRQFVGSSAEFMTAWRKYDTDRSGYIESNELKGFLSDLLKKAN 142

  Fly   114 ---GEKLTDEEVDEMIREADIDGDGQVNYEEFVTMM 146
               .:|..:|....:::..|::|||::...|...::
Zfish   143 RHYNDKKLNEYTQTILKMFDLNGDGKLGLSEMARLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 41/166 (25%)
calb2bNP_957005.1 PTZ00184 13..178 CDD:185504 41/164 (25%)
EFh 20..90 CDD:238008 21/69 (30%)
EFh 109..178 CDD:238008 17/68 (25%)
EF-hand_7 155..218 CDD:290234 5/24 (21%)
EFh 157..223 CDD:238008 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.