DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CG11041

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_611453.2 Gene:CG11041 / 37278 FlyBaseID:FBgn0034481 Length:155 Species:Drosophila melanogaster


Alignment Length:146 Identity:47/146 - (32%)
Similarity:81/146 - (55%) Gaps:10/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA-DGNGTIDFPEFL 70
            |::|:   :||.:||..||..|..:|:|||:|.||..|||.|:.::|:..:: :.:|.:...:||
  Fly    10 EKRIS---DAFCVFDHHGDKFIDVREVGTVLRLLGCVPTEEEVNEVISATESEETSGEVHLTKFL 71

  Fly    71 -----TMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
                 .:|.|||:.. ..|:|.:||::.|.:..|:::......:|...||..|.||:|||...|.
  Fly    72 PHVSQLLMERKMEPA-PPEKILQAFKILDPENKGYLTKESFGKLMMEEGEPFTQEEMDEMWPVAI 135

  Fly   131 IDGDGQVNYEEFVTMM 146
            ....|.:.||.::..:
  Fly   136 DPISGHIPYEFYLNQL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 47/146 (32%)
CG11041NP_611453.2 EF-hand_6 12..41 CDD:290141 13/31 (42%)
PTZ00184 15..152 CDD:185504 45/138 (33%)
EFh 90..>130 CDD:298682 12/39 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.