DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Calml5

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_344628.5 Gene:Calml5 / 364774 RGDID:1310047 Length:147 Species:Rattus norvegicus


Alignment Length:149 Identity:69/149 - (46%)
Similarity:105/149 - (70%) Gaps:2/149 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            |:...|:||:||..:||...||:.||.|..:|||.||:.:|:|..|.:|:.:|:.:|.||:|||.
  Rat     1 MSHGFTKEQVAELHQAFDRVDKNKDGRINVQELGDVMKQMGKNIPEKDLKALISRIDTDGDGTIS 65

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            |.||||.|.:..|  .|:||::..|||||::|:|:|:..||:..::.:||.|::||:::|||.||
  Rat    66 FEEFLTAMEKYKK--GSKEELQAVFRVFDQNGDGYITMDELKQGLSQMGETLSEEELNDMIRVAD 128

  Fly   131 IDGDGQVNYEEFVTMMTSK 149
            .|.||:||||||:.:...|
  Rat   129 ADQDGKVNYEEFLRVFLEK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 68/147 (46%)
Calml5XP_344628.5 PTZ00184 1..147 CDD:185504 68/147 (46%)
EFh 12..73 CDD:238008 29/60 (48%)
EFh 83..142 CDD:238008 30/58 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.