DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Caln1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_017453894.1 Gene:Caln1 / 363909 RGDID:1305843 Length:293 Species:Rattus norvegicus


Alignment Length:143 Identity:45/143 - (31%)
Similarity:81/143 - (56%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69
            ::.|::.|.:|||.:.|:||:|.|:.:|||..|||||..|:|.||..::..:|.||:|.:||.||
  Rat   107 ISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEF 171

  Fly    70 LTMMARKMKDTDSEE-----EIREAFRVFDKDGNGFISAAELRHVMTN-LGEKLTDEEVDEMIRE 128
            :|::..|:..::..:     .|...|..||...   ::..||:|::.: ..:.||.::::.:|  
  Rat   172 MTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQR---VTLEELKHILYHAFRDHLTMKDIENII-- 231

  Fly   129 ADIDGDGQVNYEE 141
                    :|.||
  Rat   232 --------INEEE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 45/143 (31%)
Caln1XP_017453894.1 PTZ00184 106..>216 CDD:185504 39/111 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.