DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and tnnc1a

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_852475.3 Gene:tnnc1a / 353247 ZFINID:ZDB-GENE-030523-1 Length:161 Species:Danio rerio


Alignment Length:150 Identity:79/150 - (52%)
Similarity:112/150 - (74%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADQLTEEQIAEFKEAFSLFDKDG-DGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            |:|||:||..||:.||.:|.:|. ||.|:|||||.|||.||||||..|||:||:|||.||:||:|
Zfish     9 AEQLTDEQKNEFRAAFDIFVQDAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVD 73

  Fly    66 FPEFLTMMARKMKDTDS----EEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 126
            |.|||.||.|.||| ||    |||:.|.||:|||:.:|:|...||:.::...||.:|:::::|::
Zfish    74 FEEFLVMMVRCMKD-DSKGRPEEELAELFRMFDKNADGYIDLDELKLMLEATGEAITEDDIEELM 137

  Fly   127 READIDGDGQVNYEEFVTMM 146
            |:.|.:.||:::|:||:..|
Zfish   138 RDGDKNNDGKIDYDEFLEFM 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 78/149 (52%)
tnnc1aNP_852475.3 EFh_PEF 9..157 CDD:330173 78/148 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.