DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and calm2a

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_956290.1 Gene:calm2a / 336121 ZFINID:ZDB-GENE-030804-3 Length:149 Species:Danio rerio


Alignment Length:149 Identity:146/149 - (97%)
Similarity:148/149 - (99%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            ||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||
Zfish    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREAD 130

  Fly   131 IDGDGQVNYEEFVTMMTSK 149
            |||||||||||||.|||:|
Zfish   131 IDGDGQVNYEEFVQMMTAK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 145/147 (99%)
calm2aNP_956290.1 PTZ00184 1..149 CDD:185504 145/147 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5310
eggNOG 1 0.900 - - E33208_3BAEQ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H116117
Inparanoid 1 1.050 292 1.000 Inparanoid score I2769
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 1 1.000 - - otm26197
orthoMCL 1 0.900 - - OOG6_100851
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R162
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.870

Return to query results.
Submit another query.