DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and efhd1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001292523.1 Gene:efhd1 / 335521 ZFINID:ZDB-GENE-030131-7461 Length:227 Species:Danio rerio


Alignment Length:143 Identity:36/143 - (25%)
Similarity:57/143 - (39%) Gaps:37/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            |:|..|.|...:......:.    |||...|::...      ||                     
Zfish    35 MSDDTTSELTEKLNRRLDIH----DGTAKPKQMKVF------NP--------------------- 68

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            :.||.....:::||.::      .|:.||...:|||...||:.:|..||...|...:..||:|.|
Zfish    69 YTEFKEFSRKQIKDMET------MFKRFDSGKDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVD 127

  Fly   131 IDGDGQVNYEEFV 143
            .|.||:::|.||:
Zfish   128 EDYDGKLSYREFL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 36/143 (25%)
efhd1NP_001292523.1 EF-hand_7 83..140 CDD:290234 21/62 (34%)
EFh 86..140 CDD:238008 21/53 (40%)
EF-hand_7 119..182 CDD:290234 10/22 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.