DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and myl12.1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_999864.1 Gene:myl12.1 / 326719 ZFINID:ZDB-GENE-030131-4918 Length:172 Species:Danio rerio


Alignment Length:146 Identity:66/146 - (45%)
Similarity:90/146 - (61%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            |.||   .||.||||||::.|::.||.|..::|..::.|||:||.:..|:.|:.|..    |.|:
Zfish    25 MFDQ---SQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPADDYLEAMMTEAP----GPIN 82

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            |..||||...|:..||.||.||.||..||::|.|||....||.::|.:|::.|||||||:.|||.
Zfish    83 FTMFLTMFGEKLNGTDPEEVIRNAFACFDEEGTGFIHEDYLRELLTTMGDRFTDEEVDELFREAP 147

  Fly   131 IDGDGQVNYEEFVTMM 146
            ||.....||.||..::
Zfish   148 IDKKSNFNYVEFTRIL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 66/146 (45%)
myl12.1NP_999864.1 FRQ1 19..169 CDD:227455 66/146 (45%)
EFh 33..>77 CDD:238008 18/43 (42%)
EFh 103..164 CDD:298682 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.