DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and HPCAL1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001245286.1 Gene:HPCAL1 / 3241 HGNCID:5145 Length:193 Species:Homo sapiens


Alignment Length:146 Identity:38/146 - (26%)
Similarity:72/146 - (49%) Gaps:32/146 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMA 74
            :.|||:.::.|...||   .:|....|.|:.                |.:|:|||||.||:..::
Human    45 VDEFKKIYANFFPYGD---ASKFAEHVFRTF----------------DTNGDGTIDFREFIIALS 90

  Fly    75 RKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNL------------GEKLTDEEVDEMIR 127
            ...:. ..|::::.||.::|.||||:||.:|:..::..:            .|...::..|::.|
Human    91 VTSRG-KLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFR 154

  Fly   128 EADIDGDGQVNYEEFV 143
            :.|.:.||:::.|||:
Human   155 QMDTNNDGKLSLEEFI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 38/146 (26%)
HPCAL1NP_001245286.1 FRQ1 13..179 CDD:227455 38/146 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.