DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Calml3

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001012054.1 Gene:Calml3 / 307100 RGDID:1305499 Length:149 Species:Rattus norvegicus


Alignment Length:149 Identity:132/149 - (88%)
Similarity:142/149 - (95%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            ||:|||||||||||||||||||||||.|||:|||||||||||||||||||||:||:|.|||||:|
  Rat     1 MANQLTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQDMVNEIDKDGNGTVD 65

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            ||||||||:||||||||||||||||||||||||||:||||||||||.|||||:||||||||:.||
  Rat    66 FPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIQAAD 130

  Fly   131 IDGDGQVNYEEFVTMMTSK 149
            .||||||||||||.|:.||
  Rat   131 TDGDGQVNYEEFVHMLVSK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 130/147 (88%)
Calml3NP_001012054.1 PTZ00184 1..149 CDD:185504 130/147 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.990

Return to query results.
Submit another query.