DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Aif1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_006256123.1 Gene:Aif1 / 29427 RGDID:61924 Length:240 Species:Rattus norvegicus


Alignment Length:66 Identity:22/66 - (33%)
Similarity:33/66 - (50%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAR 75
            |::.|    ||.:|:|.|....|..::..||...|..||:.:|.||.:....|..:.:||.||..
  Rat   145 AKYME----FDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLG 205

  Fly    76 K 76
            |
  Rat   206 K 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 22/66 (33%)
Aif1XP_006256123.1 EFh 150..203 CDD:238008 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.