DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Tnnc1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001029277.1 Gene:Tnnc1 / 290561 RGDID:1309921 Length:161 Species:Rattus norvegicus


Alignment Length:148 Identity:76/148 - (51%)
Similarity:108/148 - (72%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DQLTEEQIAEFKEAFSLFDKDG-DGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF 66
            :||||||..|||.||.:|.... ||.|:|||||.|||.||||||..|||:||:|||.||:||:||
  Rat    10 EQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDF 74

  Fly    67 PEFLTMMARKMKDTD---SEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 128
            .|||.||.|.|||..   ||||:.:.||:|||:.:|:|...||:.::...||.:|:::::|::::
  Rat    75 DEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMMLQATGETITEDDIEELMKD 139

  Fly   129 ADIDGDGQVNYEEFVTMM 146
            .|.:.||:::|:||:..|
  Rat   140 GDKNNDGRIDYDEFLEFM 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 76/148 (51%)
Tnnc1NP_001029277.1 PTZ00184 9..157 CDD:185504 75/146 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.