powered by:
Protein Alignment Cam and PC1
DIOPT Version :9
Sequence 1: | NP_001246276.1 |
Gene: | Cam / 36329 |
FlyBaseID: | FBgn0000253 |
Length: | 149 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001318585.1 |
Gene: | PC1 / 28721170 |
AraportID: | AT5G17480 |
Length: | 83 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 28/66 - (42%) |
Similarity: | 40/66 - (60%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEE 141
|.|...:.|....|:.||.:|:|.||||||...:..|| .:|.::|..|:.|.|.||||.::|:|
plant 1 MADATEKAEHDRIFKKFDANGDGKISAAELEEALKTLG-SVTADDVKRMMAEIDTDGDGNISYQE 64
Fly 142 F 142
|
plant 65 F 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.