DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Cetn2

DIOPT Version :10

Sequence 1:NP_523710.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_062278.2 Gene:Cetn2 / 26370 MGIID:1347085 Length:172 Species:Mus musculus


Alignment Length:143 Identity:75/143 - (52%)
Similarity:102/143 - (71%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
            :|||:|..|.:|||.|||.||.|||..|||...||:||..|.:.|::.||:|:|.:|.|.::|.:
Mouse    24 ELTEDQKQEIREAFDLFDADGTGTIDIKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSD 88

  Fly    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDG 133
            |||:|.:||.:.|::|||.:||::||.|..|.||...|:.|...|||.|||||:.|||.|||.||
Mouse    89 FLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDG 153

  Fly   134 DGQVNYEEFVTMM 146
            ||:||.:||:.:|
Mouse   154 DGEVNEQEFLRIM 166

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CamNP_523710.1 PTZ00184 1..149 CDD:185504 75/143 (52%)
Cetn2NP_062278.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 4/6 (67%)