DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and GCA

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_006712461.1 Gene:GCA / 25801 HGNCID:15990 Length:259 Species:Homo sapiens


Alignment Length:124 Identity:28/124 - (22%)
Similarity:57/124 - (45%) Gaps:14/124 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGTITTKELGTVMRSLGQNPTEAEL-----QDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEE 84
            ||.:..:||...:...|.|.|.:..     :.||..:|.|..|.:.|..|..:.|       :..
Human    91 DGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWA-------ALN 148

  Fly    85 EIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFV 143
            ..:|.|...|:||:|.:...|||..:..:|.:|:.:.:..:::.  ...:|::.::::|
Human   149 AWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKR--YSKNGRIFFDDYV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 28/124 (23%)
GCAXP_006712461.1 EFh 90..145 CDD:298682 14/53 (26%)
EFh 120..174 CDD:298682 17/60 (28%)
EF-hand_7 151..206 CDD:290234 13/57 (23%)
EFh 151..206 CDD:298682 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.