DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and cam1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_593340.1 Gene:cam1 / 2543039 PomBaseID:SPAC3A12.14 Length:150 Species:Schizosaccharomyces pombe


Alignment Length:145 Identity:111/145 - (76%)
Similarity:130/145 - (89%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69
            ||:||||||:|||||||:|.||.||:.|||.|||||||:||.||||||||||||||||||||.||
pombe     6 LTDEQIAEFREAFSLFDRDQDGNITSNELGVVMRSLGQSPTAAELQDMINEVDADGNGTIDFTEF 70

  Fly    70 LTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGD 134
            ||||||||||||:|||:||||:||||||||:|:..||.||:|:|||:|:.|||.:||||||.|||
pombe    71 LTMMARKMKDTDNEEEVREAFKVFDKDGNGYITVEELTHVLTSLGERLSQEEVADMIREADTDGD 135

  Fly   135 GQVNYEEFVTMMTSK 149
            |.:|||||..:::||
pombe   136 GVINYEEFSRVISSK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 109/143 (76%)
cam1NP_593340.1 PTZ00184 5..150 CDD:185504 109/143 (76%)
EFh 13..75 CDD:238008 51/61 (84%)
EFh 86..148 CDD:238008 41/61 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I1678
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I864
OMA 1 1.010 - - QHG53747
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 1 1.000 - - oto101736
orthoMCL 1 0.900 - - OOG6_100851
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R162
SonicParanoid 1 1.000 - - X199
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.