DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and cdc4

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_594947.1 Gene:cdc4 / 2541699 PomBaseID:SPAP8A3.08 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:57/136 - (41%)
Similarity:85/136 - (62%) Gaps:7/136 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK- 76
            :|:||||||:.|.|.|....:|.::|:.|||||.||    |.|:::.....:|..:||.::.|. 
pombe     8 YKQAFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAE----ITEIESTLPAEVDMEQFLQVLNRPN 68

  Fly    77 -MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE 140
             .......||..:.|:|||||..|.|...|||:|:|:|||||::||:||:::...:. ||.|||.
pombe    69 GFDMPGDPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGVPVK-DGMVNYH 132

  Fly   141 EFVTMM 146
            :||.|:
pombe   133 DFVQMI 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 57/136 (42%)
cdc4NP_594947.1 PTZ00184 8..141 CDD:185504 57/136 (42%)
EF-hand_6 8..36 CDD:290141 12/27 (44%)
EFh 78..138 CDD:238008 30/60 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.