DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Calm1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_114175.1 Gene:Calm1 / 24242 RGDID:2257 Length:149 Species:Rattus norvegicus


Alignment Length:149 Identity:146/149 - (97%)
Similarity:148/149 - (99%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            ||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||
  Rat    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREAD 130

  Fly   131 IDGDGQVNYEEFVTMMTSK 149
            |||||||||||||.|||:|
  Rat   131 IDGDGQVNYEEFVQMMTAK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 145/147 (99%)
Calm1NP_114175.1 PTZ00184 1..149 CDD:185504 145/147 (99%)
Necessary and sufficient for interaction with PCP4. /evidence=ECO:0000250|UniProtKB:P0DP23 77..149 69/71 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5238
eggNOG 1 0.900 - - E33208_3BAEQ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H116117
Inparanoid 1 1.050 292 1.000 Inparanoid score I2683
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 1 1.000 - - otm45961
orthoMCL 1 0.900 - - OOG6_100851
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.880

Return to query results.
Submit another query.