DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Cetn4

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_665824.1 Gene:Cetn4 / 207175 MGIID:2677454 Length:168 Species:Mus musculus


Alignment Length:143 Identity:70/143 - (48%)
Similarity:96/143 - (67%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
            :|.:.|..|.||||.|||.||.|||..|||...||:||..|.:.|::.:|.|:|.:|.|||.|.:
Mouse    20 ELNDTQKQEIKEAFDLFDIDGSGTIDLKELKIAMRALGFEPKKEEVKQLIAEIDKEGTGTICFED 84

  Fly    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDG 133
            |..:|:.||.:.|.:|||.:||::||.|..|.||...::.|...|||.||::|:.||:.|||.||
Mouse    85 FFAIMSVKMSEKDEKEEILKAFKLFDDDATGSISLNNIKRVAKELGENLTEDELQEMLDEADRDG 149

  Fly   134 DGQVNYEEFVTMM 146
            ||::|.|||:.||
Mouse   150 DGEINEEEFLKMM 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 70/143 (49%)
Cetn4NP_665824.1 EFh_PEF 13..168 CDD:330173 70/143 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.